PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 336aa    MW: 37120.1 Da    PI: 6.836
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21626genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52101391129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
               +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + + +
  EMT21626  10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKCIRT-SYR 108
               69****************************.99**************963433332566*************************************9.899 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
               ++g++ktLvfy+grap+g+k+dW+mheyrle
  EMT21626 109 KIGMRKTLVFYRGRAPHGQKSDWIMHEYRLE 139
               9****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-596161IPR003441NAC domain
PROSITE profilePS5100557.38810161IPR003441NAC domain
PfamPF023653.0E-2711138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MADFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWDLQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKSD WIMHEYRLEE IDEAQGGTSE DGWVVCRVFK KKCFFKIAGG GEGSSSQSAD  180
AGAGHMAVSS PLGGHDHADR AAMASHYMHG MHPQYHPQHA SSFYYSQMQP PEAAYSHHVQ  240
VQDLLTNHRP AADAAGGGYD FSGLPVEHPG LDVGSSDGVA ADGLAEGRDQ TNGAADQQWQ  300
PMDGFSNGGG AAAVQQMSAM NSGQRGGEMD LWGYGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-541016217166NAC domain-containing protein 19
4dul_A1e-541016217166NAC domain-containing protein 19
1ut7_B1e-541016217166NO APICAL MERISTEM PROTEIN
1ut7_A1e-541016217166NO APICAL MERISTEM PROTEIN
1ut4_B1e-541016217166NO APICAL MERISTEM PROTEIN
1ut4_A1e-541016217166NO APICAL MERISTEM PROTEIN
3swp_D2e-541016220169NAC domain-containing protein 19
3swp_C2e-541016220169NAC domain-containing protein 19
3swp_B2e-541016220169NAC domain-containing protein 19
3swp_A2e-541016220169NAC domain-containing protein 19
3swm_D2e-541016220169NAC domain-containing protein 19
3swm_C2e-541016220169NAC domain-containing protein 19
3swm_B2e-541016220169NAC domain-containing protein 19
3swm_A2e-541016220169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715420.0EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661033.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-111BRN2_ARATH; Protein BEARSKIN2
TrEMBLM8CEM30.0M8CEM3_AEGTA; NAC domain-containing protein 12
TrEMBLW5B7L70.0W5B7L7_WHEAT; Uncharacterized protein
STRINGMLOC_19175.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.12e-91NAC domain containing protein 70